NumberOfShareOptionsOutstandingInSharebasedPaymentArrangementAtFairValueOfOptionsGranted.

No definition available.

Name:	asx_Numberofshareoptionsoutstandinginsharebasedpaymentarrangementatfairvalueofoptionsgranted
Namespace Prefix:	asx_
Data Type:	xbrli:decimalItemType
Balance Type:	na
Period Type:	duration

- Definition

Line items represent concepts included in a table. These concepts are used to disclose reportable information associated with domain members defined in one or many axes of the table.

+ References

No definition available.

+ Details

Name:	ifrs-full_DisclosureOfTermsAndConditionsOfSharebasedPaymentArrangementLineItems
Namespace Prefix:	ifrs-full_
Data Type:	xbrli:stringItemType
Balance Type:	na
Period Type:	duration

- Definition

The number of share options outstanding in a share-based payment arrangement.

+ References

Reference 1: http://www.xbrl.org/2003/role/disclosureRef
-Name IFRS
-Number 2
-IssueDate 2019-01-01
-Paragraph 45
-Subparagraph d
-URI http://eifrs.ifrs.org/eifrs/xifrs-link?type=IFRS&num=2&code=ifrs-tx-2019-en-r&anchor=para_45_d&doctype=Standard
-URIDate 2019-03-27

Reference 2: http://www.xbrl.org/2003/role/disclosureRef
-Name IFRS
-Number 2
-IssueDate 2019-01-01
-Paragraph 45
-Subparagraph b
-Clause i
-URI http://eifrs.ifrs.org/eifrs/xifrs-link?type=IFRS&num=2&code=ifrs-tx-2019-en-r&anchor=para_45_b_i&doctype=Standard
-URIDate 2019-03-27

Reference 3: http://www.xbrl.org/2003/role/disclosureRef
-Name IFRS
-Number 2
-IssueDate 2019-01-01
-Paragraph 45
-Subparagraph b
-Clause vi
-URI http://eifrs.ifrs.org/eifrs/xifrs-link?type=IFRS&num=2&code=ifrs-tx-2019-en-r&anchor=para_45_b_vi&doctype=Standard
-URIDate 2019-03-27

+ Details

Name:	ifrs-full_NumberOfOutstandingShareOptions
Namespace Prefix:	ifrs-full_
Data Type:	xbrli:decimalItemType
Balance Type:	na
Period Type:	instant

- Definition

The number of share options exercisable in a share-based payment arrangement.

+ References

Reference 1: http://www.xbrl.org/2003/role/disclosureRef
-Name IFRS
-Number 2
-IssueDate 2019-01-01
-Paragraph 45
-Subparagraph b
-Clause vii
-URI http://eifrs.ifrs.org/eifrs/xifrs-link?type=IFRS&num=2&code=ifrs-tx-2019-en-r&anchor=para_45_b_vii&doctype=Standard
-URIDate 2019-03-27

+ Details

Name:	ifrs-full_NumberOfShareOptionsExercisableInSharebasedPaymentArrangement
Namespace Prefix:	ifrs-full_
Data Type:	xbrli:decimalItemType
Balance Type:	na
Period Type:	instant

- Definition

The number of share options exercised in a share-based payment arrangement.

+ References

Reference 1: http://www.xbrl.org/2003/role/disclosureRef
-Name IFRS
-Number 2
-IssueDate 2019-01-01
-Paragraph 45
-Subparagraph b
-Clause iv
-URI http://eifrs.ifrs.org/eifrs/xifrs-link?type=IFRS&num=2&code=ifrs-tx-2019-en-r&anchor=para_45_b_iv&doctype=Standard
-URIDate 2019-03-27

+ Details

Name:	ifrs-full_NumberOfShareOptionsExercisedInSharebasedPaymentArrangement
Namespace Prefix:	ifrs-full_
Data Type:	xbrli:decimalItemType
Balance Type:	na
Period Type:	duration

- Definition

The number of share options forfeited in a share-based payment arrangement.

+ References

Reference 1: http://www.xbrl.org/2003/role/disclosureRef
-Name IFRS
-Number 2
-IssueDate 2019-01-01
-Paragraph 45
-Subparagraph b
-Clause iii
-URI http://eifrs.ifrs.org/eifrs/xifrs-link?type=IFRS&num=2&code=ifrs-tx-2019-en-r&anchor=para_45_b_iii&doctype=Standard
-URIDate 2019-03-27

+ Details

Name:	ifrs-full_NumberOfShareOptionsForfeitedInSharebasedPaymentArrangement
Namespace Prefix:	ifrs-full_
Data Type:	xbrli:decimalItemType
Balance Type:	na
Period Type:	duration

- Definition

The number of share options granted in a share-based payment arrangement.

+ References

Reference 1: http://www.xbrl.org/2003/role/disclosureRef
-Name IFRS
-Number 2
-IssueDate 2019-01-01
-Paragraph 45
-Subparagraph b
-Clause ii
-URI http://eifrs.ifrs.org/eifrs/xifrs-link?type=IFRS&num=2&code=ifrs-tx-2019-en-r&anchor=para_45_b_ii&doctype=Standard
-URIDate 2019-03-27

+ Details

Name:	ifrs-full_NumberOfShareOptionsGrantedInSharebasedPaymentArrangement
Namespace Prefix:	ifrs-full_
Data Type:	xbrli:decimalItemType
Balance Type:	na
Period Type:	duration

- Definition

The weighted average exercise price of share options exercisable in a share-based payment arrangement. [Refer: Weighted average [member]]

+ References

+ Details

Name:	ifrs-full_WeightedAverageExercisePriceOfShareOptionsExercisableInSharebasedPaymentArrangement2019
Namespace Prefix:	ifrs-full_
Data Type:	num:perShareItemType
Balance Type:	na
Period Type:	instant

- Definition

The weighted average exercise price of share options exercised in a share-based payment arrangement. [Refer: Weighted average [member]]

+ References

+ Details

Name:	ifrs-full_WeightedAverageExercisePriceOfShareOptionsExercisedInSharebasedPaymentArrangement2019
Namespace Prefix:	ifrs-full_
Data Type:	num:perShareItemType
Balance Type:	na
Period Type:	duration

- Definition

The weighted average exercise price of share options forfeited in a share-based payment arrangement. [Refer: Weighted average [member]]

+ References

+ Details

Name:	ifrs-full_WeightedAverageExercisePriceOfShareOptionsForfeitedInSharebasedPaymentArrangement2019
Namespace Prefix:	ifrs-full_
Data Type:	num:perShareItemType
Balance Type:	na
Period Type:	duration

- Definition

The weighted average exercise price of share options granted in a share-based payment arrangement. [Refer: Weighted average [member]]

+ References

+ Details

Name:	ifrs-full_WeightedAverageExercisePriceOfShareOptionsGrantedInSharebasedPaymentArrangement2019
Namespace Prefix:	ifrs-full_
Data Type:	num:perShareItemType
Balance Type:	na
Period Type:	duration

- Definition

The weighted average exercise price of share options outstanding in a share-based payment arrangement. [Refer: Weighted average [member]]

+ References

Reference 1: http://www.xbrl.org/2003/role/disclosureRef
-Name IFRS
-Number 2
-IssueDate 2019-01-01
-Paragraph 45
-Subparagraph b
-Clause i
-URI http://eifrs.ifrs.org/eifrs/xifrs-link?type=IFRS&num=2&code=ifrs-tx-2019-en-r&anchor=para_45_b_i&doctype=Standard
-URIDate 2019-03-27

Reference 2: http://www.xbrl.org/2003/role/disclosureRef
-Name IFRS
-Number 2
-IssueDate 2019-01-01
-Paragraph 45
-Subparagraph b
-Clause vi
-URI http://eifrs.ifrs.org/eifrs/xifrs-link?type=IFRS&num=2&code=ifrs-tx-2019-en-r&anchor=para_45_b_vi&doctype=Standard
-URIDate 2019-03-27

+ Details

Name:	ifrs-full_WeightedAverageExercisePriceOfShareOptionsOutstandingInSharebasedPaymentArrangement2019
Namespace Prefix:	ifrs-full_
Data Type:	num:perShareItemType
Balance Type:	na
Period Type:	instant

- Details

Name:	ifrs-full_TypesOfSharebasedPaymentArrangementsAxis=asx_USISHOptionPlansMember
Namespace Prefix:
Data Type:	na
Balance Type:
Period Type:

- Details

Name:	ifrs-full_RangeAxis=ifrs-full_BottomOfRangeMember
Namespace Prefix:
Data Type:	na
Balance Type:
Period Type:

- Details

Name:	ifrs-full_RangeAxis=ifrs-full_TopOfRangeMember
Namespace Prefix:
Data Type:	na
Balance Type:
Period Type:

Share-based Payment Arrangements - Summary of Information About USISH Option Plans (Detail)	8 Months Ended	12 Months Ended
	Dec. 31, 2018 shares $ / shares ¥ / shares	Dec. 31, 2019 shares $ / shares ¥ / shares	Dec. 31, 2019 shares ¥ / shares	Dec. 31, 2018 shares $ / shares ¥ / shares	Dec. 31, 2018 shares ¥ / shares	Dec. 31, 2017 shares ¥ / shares
Disclosure of terms and conditions of share-based payment arrangement [Line Items]
Weighted average exercise price, Beginning balance \| $ / shares		$ 58.1
Weighted average exercise price options granted \| $ / shares	$ 56.4
Weighted average exercise price, Options forfeited \| $ / shares	71.5
Weighted average exercise price, Ending balance \| $ / shares	$ 58.1			$ 58.1
USISH option plans [member]
Disclosure of terms and conditions of share-based payment arrangement [Line Items]
Number of options, beginning balance		21,537,000	21,537,000	22,341,000	22,341,000	24,997,000
Number of options, granted		23,323,000	23,323,000
Number of options, exercised		(3,164,000)	(3,164,000)
Number of options, forfeited		(463,000)	(463,000)	(804,000)	(804,000)	(2,656,000)
Number of options, Ending balance	21,537,000	41,233,000	41,233,000	21,537,000	21,537,000	22,341,000
Number of options, exercisable, end of year	12,884,000	13,694,000	13,694,000	12,884,000	12,884,000	8,896,000
Weighted average exercise price, Beginning balance \| ¥ / shares			¥ 15.5		¥ 15.5	¥ 15.5
Weighted average exercise price options granted \| ¥ / shares			13.3
Weighted average exercise price options exercised \| ¥ / shares			15.5
Weighted average exercise price, Options forfeited \| ¥ / shares			15.4		15.5	15.5
Weighted average exercise price, Ending balance \| ¥ / shares			14.3		15.5	15.5
Weighted average exercise price, Options exercisable, end of year \| ¥ / shares	$ 15.5	$ 15.5	¥ 15.5	$ 15.5	¥ 15.5	¥ 15.5
USISH option plans [member] \| Bottom of range [member]
Disclosure of terms and conditions of share-based payment arrangement [Line Items]
Fair value of options granted (CNY)		6.27	6.27
USISH option plans [member] \| Top of range [member]
Disclosure of terms and conditions of share-based payment arrangement [Line Items]
Fair value of options granted (CNY)		13.47	13.47